PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G375000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 1140aa    MW: 127900 Da    PI: 4.8141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G375000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-13853248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Aqcoe2G375000.1.p  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                       78*****************************.************986 PP

2Myb_DNA-binding32.61.9e-1060103248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  Aqcoe2G375000.1.p  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                        68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001675.33E-121053No hitNo description
PfamPF139215.7E-131070No hitNo description
SuperFamilySSF466898.99E-2133107IPR009057Homeodomain-like
CDDcd116591.10E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.8E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118318.2E-56426672IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1140 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKKPP AGFFDVADEE THVEQPKFPT  240
TIEELEGKRR VDVEAQLRKQ DIARNKIAQR QDAPSSILQV NKLNDPESVR KRSKLMLPAP  300
QITDHELEEI AKMGYASDIV SGSEHIGEGS GATRALLANY AQTPQQGMTP FRTPQRTPGG  360
KADAIMMEAE NLARLRESQT PLLGGDNPEL HPSDFSGVTP KKREIQTPHP MSTPSTPGAM  420
GLTPRSGMTP SAGLTPRIGM TPSRDGYSFG MTPKGTPIRD ELRINISEDM DVHDGAKHEL  480
RSQAELRRDL RSGLTSLPQP KNEYQIVVQP LPEENDEPED KVEEDMSDKI AREKAEEEAK  540
QQELLKKRSK VLQRELPRPP PASVELIKNS LMKSDEDKSS FVPPTSFEQA DEMIRKELLS  600
LLEHDNAKYP LEEKVGKEKK KGGKRAPSGK STTFVPEIEE FANDILKEAD SLINEEIEYL  660
RVAMGHGNES LDEFVKAHDA CQEDLMYFPT RYAYGLSSVA GNMEKLTALQ HEFENVKNRM  720
DDETKKVQRL EQKIKLLTHG YQTRGGKLWS QIEATFKQMN TAATELECFQ ALQKQEHYAA  780
SHRINVLFEE INRQKELEEN LQKRYGDLVA EKERIQRLLE EHKRQAQIQE EIDSQNCALE  840
ESKLQAQIQE EIAEKNRAFE LSISAADQVD NVQEQVTDAI PKDPGTDMDV DSHLDSTSLE  900
ANLTKDDMVV GKAMLVQDSC CKGPNSSDQP LTADNDDTSG VIVQILNVPV QEVALNGGPA  960
PTLLGTEEMH MTSDSVMDQM PPGIGDSLKI SQEEINVMSE NSHMESKILV EEQLVVMEAG  1020
TQDGIVMEAE ASLRHSSMDS LKVSQEELNA TSENSNMESK ILVEEQLVVT GAGMQDGIVT  1080
KSEASLEDSL DAGRENITIS SSEKRIVVNL DGEADENLKC GVDAVSNNET MPVLNEDLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246794.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM0U2U30.0M0U2U3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P23340_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5